PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G159100.1.p
Common NameSb06g023610, SORBIDRAFT_06g023610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 299aa    MW: 31824.5 Da    PI: 6.4154
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G159100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.6e-151562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l d++ ++G g+W++ + + g+ R +k+c++rw +yl
  Sobic.006G159100.1.p 15 KGLWSPEEDEKLRDYILRYGHGCWSALPLKAGLQRNGKSCRLRWINYL 62
                          678*******************************************97 PP

2Myb_DNA-binding53.65e-1769113248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           g ++ eE+e    ++++lG++ W+ Iar+++ gRt++++k++w++yl
  Sobic.006G159100.1.p  69 GVFSREEEETVMSLHAKLGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                           789******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6881062IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.8E-211065IPR009057Homeodomain-like
SuperFamilySSF466892.85E-2813109IPR009057Homeodomain-like
SMARTSM007179.6E-111464IPR001005SANT/Myb domain
PfamPF002498.6E-131562IPR001005SANT/Myb domain
CDDcd001672.92E-101862No hitNo description
PROSITE profilePS5129425.92763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2566116IPR009057Homeodomain-like
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PfamPF002492.2E-1569113IPR001005SANT/Myb domain
CDDcd001672.96E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGCKACQKPK VQYRKGLWSP EEDEKLRDYI LRYGHGCWSA LPLKAGLQRN GKSCRLRWIN  60
YLRPGLKHGV FSREEEETVM SLHAKLGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGG  120
AQGKHGAADP ATPGRSDVHG SPDDPSENNG QGSVVSRPAN SDSSEPAVES SSADDSSCLT  180
VTEPAGARAS ATAAVRPHAP VLPKVMFADW LDMDYGTSLV ALGPDAGVFD VGGRSPAQGL  240
SHQGSSVQVD GPSCGAVDSL HGLGGMCWEF DAAADQLDVQ GGGGFCDLLS MSEFLGIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24151187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915921e-156FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446849.10.0hypothetical protein SORBIDRAFT_06g023610
TrEMBLC5YCX00.0C5YCX0_SORBI; Putative uncharacterized protein Sb06g023610
STRINGSb06g023610.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-57myb domain protein 18